Bio Glycoengineering

N-Glycosylation Sequon Analysis

Scanning for N-Glycosylation Sites

N-glycosylation occurs at the sequon N-X-[S/T] where X ≠ Proline.

import re
from typing import List, Tuple

def find_n_glycosylation_sequons(sequence: str) -> List[dict]:
    """
    Scan a protein sequence for canonical N-linked glycosylation sequons.
    Motif: N-X-[S/T], where X ≠ Proline.

    Args:
        sequence: Single-letter amino acid sequence

    Returns:
        List of dicts with position (1-based), motif, and context
    """
    seq = sequence.upper()
    results = []
    i = 0
    while i <= len(seq) - 3:
        triplet = seq[i:i+3]
        if triplet[0] == 'N' and triplet[1] != 'P' and triplet[2] in {'S', 'T'}:
            context = seq[max(0, i-3):i+6]  # ±3 residue context
            results.append({
                'position': i + 1,   # 1-based
                'motif': triplet,
                'context': context,
                'sequon_type': 'NXS' if triplet[2] == 'S' else 'NXT'
            })
            i += 3
        else:
            i += 1
    return results

def summarize_glycosylation_sites(sequence: str, protein_name: str = "") -> str:
    """Generate a research log summary of N-glycosylation sites."""
    sequons = find_n_glycosylation_sequons(sequence)

    lines = [f"# N-Glycosylation Sequon Analysis: {protein_name or 'Protein'}"]
    lines.append(f"Sequence length: {len(sequence)}")
    lines.append(f"Total N-glycosylation sequons: {len(sequons)}")

    if sequons:
        lines.append(f"\nN-X-S sites: {sum(1 for s in sequons if s['sequon_type'] == 'NXS')}")
        lines.append(f"N-X-T sites: {sum(1 for s in sequons if s['sequon_type'] == 'NXT')}")
        lines.append(f"\nSite details:")
        for s in sequons:
            lines.append(f"  Position {s['position']}: {s['motif']} (context: ...{s['context']}...)")
    else:
        lines.append("No canonical N-glycosylation sequons detected.")

    return "\n".join(lines)

# Example: IgG1 Fc region
fc_sequence = "APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK"
print(summarize_glycosylation_sites(fc_sequence, "IgG1 Fc"))

Mutating N-Glycosylation Sites

def eliminate_glycosite(sequence: str, position: int, replacement: str = "Q") -> str:
    """
    Eliminate an N-glycosylation site by substituting Asn → Gln (conservative).

    Args:
        sequence: Protein sequence
        position: 1-based position of the Asn to mutate
        replacement: Amino acid to substitute (default Q = Gln; similar size, not glycosylated)

    Returns:
        Mutated sequence
    """
    seq = list(sequence.upper())
    idx = position - 1
    assert seq[idx] == 'N', f"Position {position} is '{seq[idx]}', not 'N'"
    seq[idx] = replacement.upper()
    return ''.join(seq)

def add_glycosite(sequence: str, position: int, flanking_context: str = "S") -> str:
    """
    Introduce an N-glycosylation site by mutating a residue to Asn,
    and ensuring X ≠ Pro and +2 = S/T.

    Args:
        position: 1-based position to introduce Asn
        flanking_context: 'S' or 'T' at position+2 (if modification needed)
    """
    seq = list(sequence.upper())
    idx = position - 1

    # Mutate to Asn
    seq[idx] = 'N'

    # Ensure X+1 != Pro (mutate to Ala if needed)
    if idx + 1 < len(seq) and seq[idx + 1] == 'P':
        seq[idx + 1] = 'A'

    # Ensure X+2 = S or T
    if idx + 2 < len(seq) and seq[idx + 2] not in ('S', 'T'):
        seq[idx + 2] = flanking_context

    return ''.join(seq)

O-Glycosylation Analysis

Heuristic O-Glycosylation Hotspot Prediction

def predict_o_glycosylation_hotspots(
    sequence: str,
    window: int = 7,
    min_st_fraction: float = 0.4,
    disallow_proline_next: bool = True
) -> List[dict]:
    """
    Heuristic O-glycosylation hotspot scoring based on local S/T density.
    Not a substitute for NetOGlyc; use as fast baseline.

    Rules:
    - O-GalNAc glycosylation clusters on Ser/Thr-rich segments
    - Flag Ser/Thr residues in windows enriched for S/T
    - Avoid S/T immediately followed by Pro (TP/SP motifs inhibit GalNAc-T)

    Args:
        window: Odd window size for local S/T density
        min_st_fraction: Minimum fraction of S/T in window to flag site
    """
    if window % 2 == 0:
        window = 7
    seq = sequence.upper()
    half = window // 2
    candidates = []

    for i, aa in enumerate(seq):
        if aa not in ('S', 'T'):
            continue
        if disallow_proline_next and i + 1 < len(seq) and seq[i+1] == 'P':
            continue

        start = max(0, i - half)
        end = min(len(seq), i + half + 1)
        segment = seq[start:end]
        st_count = sum(1 for c in segment if c in ('S', 'T'))
        frac = st_count / len(segment)

        if frac >= min_st_fraction:
            candidates.append({
                'position': i + 1,
                'residue': aa,
                'st_fraction': round(frac, 3),
                'window': f"{start+1}-{end}",
                'segment': segment
            })

    return candidates

External Glycoengineering Tools

1. NetOGlyc 4.0 (O-glycosylation prediction)

Web service for high-accuracy O-GalNAc site prediction:

• URL: https://services.healthtech.dtu.dk/services/NetOGlyc-4.0/
• Input: FASTA protein sequence
• Output: Per-residue O-glycosylation probability scores
• Method: Neural network trained on experimentally verified O-GalNAc sites

import requests

def submit_netoglycv4(fasta_sequence: str) -> str:
    """
    Submit sequence to NetOGlyc 4.0 web service.
    Returns the job URL for result retrieval.

    Note: This uses the DTU Health Tech web service. Results take ~1-5 min.
    """
    url = "https://services.healthtech.dtu.dk/cgi-bin/webface2.cgi"
    # NetOGlyc submission (parameters may vary with web service version)
    # Recommend using the web interface directly for most use cases
    print("Submit sequence at: https://services.healthtech.dtu.dk/services/NetOGlyc-4.0/")
    return url

# Also: NetNGlyc for N-glycosylation prediction
# URL: https://services.healthtech.dtu.dk/services/NetNGlyc-1.0/

2. GlycoShield-MD (Glycan Shielding Analysis)

GlycoShield-MD analyzes how glycans shield protein surfaces during MD simulations:

• URL: https://gitlab.mpcdf.mpg.de/dioscuri-biophysics/glycoshield-md/
• Use: Map glycan shielding on protein surface over MD trajectory
• Output: Per-residue shielding fraction, visualization

# Installation
pip install glycoshield

# Basic usage: analyze glycan shielding from glycosylated protein MD trajectory
glycoshield \
    --topology glycoprotein.pdb \
    --trajectory glycoprotein.xtc \
    --glycan_resnames BGLCNA FUC \
    --output shielding_analysis/

3. GlycoWorkbench (Glycan Structure Drawing/Analysis)

• URL: https://www.eurocarbdb.org/project/glycoworkbench
• Use: Draw glycan structures, calculate masses, annotate MS spectra
• Format: GlycoCT, IUPAC condensed glycan notation

4. GlyConnect (Glycan-Protein Database)

• URL: https://glyconnect.expasy.org/
• Use: Find experimentally verified glycoproteins and glycosylation sites
• Query: By protein (UniProt ID), glycan structure, or tissue

import requests

def query_glyconnect(uniprot_id: str) -> dict:
    """Query GlyConnect for glycosylation data for a protein."""
    url = f"https://glyconnect.expasy.org/api/proteins/uniprot/{uniprot_id}"
    response = requests.get(url, headers={"Accept": "application/json"})
    if response.status_code == 200:
        return response.json()
    return {}

# Example: query EGFR glycosylation
egfr_glyco = query_glyconnect("P00533")

5. UniCarbKB (Glycan Structure Database)

• URL: https://unicarbkb.org/
• Use: Browse glycan structures, search by mass or composition
• Format: GlycoCT or IUPAC notation

Key Glycoengineering Strategies

For Therapeutic Antibodies

Common Mutations Used

Glycan Notation

IUPAC Condensed Notation (Monosaccharide abbreviations)

Complex N-Glycan Structure

Typical complex biantennary N-glycan:
Neu5Ac-Gal-GlcNAc-Man\
                       Man-GlcNAc-GlcNAc-[Asn]
Neu5Ac-Gal-GlcNAc-Man/
(±Core Fuc at innermost GlcNAc)

Best Practices

• Start with NetNGlyc/NetOGlyc for computational prediction before experimental validation
• Verify with mass spectrometry: Glycoproteomics (Byonic, Mascot) for site-specific glycan profiling
• Consider site context: Not all predicted sequons are actually glycosylated (accessibility, cell type, protein conformation)
• For antibodies: Fc N297 glycan is critical — always characterize this site first
• Use GlyConnect to check if your protein of interest has experimentally verified glycosylation data

Additional Resources

• GlyTouCan (glycan structure repository): https://glytoucan.org/
• GlyConnect: https://glyconnect.expasy.org/
• CFG Functional Glycomics: http://www.functionalglycomics.org/
• DTU Health Tech servers (NetNGlyc, NetOGlyc): https://services.healthtech.dtu.dk/
• GlycoWorkbench: https://glycoworkbench.software.informer.com/
• Review: Apweiler R et al. (1999) Biochim Biophys Acta. PMID: 10564035
• Therapeutic glycoengineering review: Jefferis R (2009) Nature Reviews Drug Discovery. PMID: 19448661